PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN40059.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 374aa    MW: 42892.2 Da    PI: 9.662
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN40059.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.1e-17108154148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W +eEd +l+++vkq+G + W+ Ia+++  gR +kqc++rw+++l
       KHN40059.1 108 KGQWNKEEDRKLIRLVKQYGERKWAEIAEKLE-GRVGKQCRERWNNHL 154
                      799*****************************.*************97 PP

2Myb_DNA-binding46.21.1e-14160202145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W++eE+ +lvd +++lG++ W  Ia+++  gR+++ +k++w+
       KHN40059.1 160 KDSWSEEEERILVDTHARLGNR-WCEIAKHIT-GRSENAIKNHWN 202
                      679*******************.********9.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.185102158IPR017930Myb domain
SuperFamilySSF466895.39E-27107201IPR009057Homeodomain-like
SMARTSM007173.3E-16107156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-27109162IPR009057Homeodomain-like
PfamPF139211.9E-18111168No hitNo description
CDDcd001671.02E-15111154No hitNo description
PROSITE profilePS5129417.678159209IPR017930Myb domain
SMARTSM007171.1E-13159207IPR001005SANT/Myb domain
CDDcd001672.05E-10162202No hitNo description
Gene3DG3DSA:1.10.10.603.5E-19163207IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MVRGGSQGGD NNGFQIYGCE VINASNNPPL TAIGIDRFLC GHFPHQQQHA RNYNAANVFA  60
DEEAFNNKWT HINQTPTLCL KGMHVLGKNA KVVRRRSKKK QSPVCWIKGQ WNKEEDRKLI  120
RLVKQYGERK WAEIAEKLEG RVGKQCRERW NNHLRPDIKK DSWSEEEERI LVDTHARLGN  180
RWCEIAKHIT GRSENAIKNH WNATIRRQNS KRKNKKTKSS INGKPHSSIL EDYIRSQNQT  240
TSSNPTPGII TATDTIHTTL SQDNAANLAN DLLFMKQIFK ENVEVSKHSK MPSTSYLDYC  300
QMNVDDVGEC EYSLQYLDIN NINMHLNDAS LFPRETHPTH ISYLPSDLHL SHLFNVAPGY  360
GNQNGFSTSR LFRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-431072083104C-Myb DNA-Binding Domain
1msf_C4e-431072083104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006596905.10.0PREDICTED: myb-related protein A-like
TrEMBLA0A0B2S7060.0A0A0B2S706_GLYSO; Transcription factor MYB98
STRINGGLYMA14G37140.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.12e-57myb domain protein 64
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]